PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID model.Picochlorum_contig_82.g332.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Picochlorum
Family SBP
Protein Properties Length: 355aa    MW: 40074.2 Da    PI: 7.8506
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
model.Picochlorum_contig_82.g332.t1genomeRutgersView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP95.16.9e-3092167277
                                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                                          C+vegCe+ +s+   y+rr+k+C++h k++  +v+g++qrfCqqC++fhe+++fD +kr Cr  L +hn+rr+k
  model.Picochlorum_contig_82.g332.t1  92 CHVEGCETVMSDETAYFRRYKICRKHLKSNYLIVAGIQQRFCQQCGKFHEVEKFDGTKRNCRATLVRHNRRRKK 165
                                          *************************************************************************9 PP

                                          -- CS
                                  SBP  76 kq 77 
                                          ++
  model.Picochlorum_contig_82.g332.t1 166 TS 167
                                          86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-2687153IPR004333Transcription factor, SBP-box
PROSITE profilePS5114124.37689166IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.79E-2690168IPR004333Transcription factor, SBP-box
PfamPF031102.4E-2892165IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MTSPDMMHMK HEEAYLVDPT PPSSDAAVVR ADDRREDENV DSEDDTTERD SEDNNMQKDS  60
KDPAPVDGVS GTIILPMQGS EFRRNDKGDV LCHVEGCETV MSDETAYFRR YKICRKHLKS  120
NYLIVAGIQQ RFCQQCGKFH EVEKFDGTKR NCRATLVRHN RRRKKTSRAK RKKSASEDED  180
SGTKQPNVTW EHPGMGAMLN SSPVNVDILK AYYGVPNPND AFPPELVNTI AELERLIGRE  240
VIHHCLQSSQ PPQMWQQNGY ATNNIFQGNG MHRYSPAPVH QSPPMMNVFQ QYGIPRSAPQ  300
HPYTSGGMPM PPPSARKQVP KGASDSMMDQ TASDILMRMK NSMPPKSQYM RMPM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-20911651084squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160172RRRKKTSRAKRKK
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.12e-20squamosa promoter binding protein-like 15